DPCstruct | MC62369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 89 ± 17 aa |
| Standard deviation of domain lengths | 17.32 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0615 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A242LMN7 | 1-84 | MEKNSFFQQGTMQMLSEGLLDGTITLKELMIHGDTGIGTGEGIDGELIILNGKGFKVNHKGEGIPLENAFKITFADVHFENYEK |
| L0R9E7 | 31-109 | LYQYSTIDSLLLGNYDGELTVDQLKKHGNTGLGTFNKLDGEMVFIDGDVYKVRADGKAVLMPATASTPFAAAVFFKTDS |
| A0A484YRF3 | 1-80 | None |
| A0A377X968 | 53-132 | None |
| A0A6J7CEL3 | 15-93 | None |
| A0A520KCM7 | 81-162 | None |
| E7H2A3 | 4-83 | None |
| A0A317C4E3 | 392-489 | None |
| A0A2S5YFK3 | 51-147 | None |
| A0A5N6G3J3 | 7-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.