DPCstruct | MC62367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 111 ± 16 aa |
| Standard deviation of domain lengths | 16.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5IHV1 | 9-95 | IVVIHWFPTQIDAHGRLMEPVNRGSAWRKQFPVPENYDDTGNNCGGYDRQHGYNRGHCGVCGDDFSLPRPRPNENGGEYGLGVIERY |
| A0A336M0X4 | 2-99 | LLDPVNRSSRWRYDQRAPINYDDNGINCGGFSMQHDTNGGKCGICGDNYLDQRPRPNELGGVYGQGTVVKTYKSGSKITATVKITAN… |
| A0A3S1B4Y4 | 19-136 | None |
| A0A2R2MRS9 | 500-620 | None |
| A0A7R9KYB7 | 97-194 | None |
| A0A182F7H6 | 18-126 | None |
| A0A1D2NIE6 | 319-412 | None |
| A0A2C9JRV6 | 4-110 | None |
| A0A812ZR35 | 12-142 | None |
| A0A2T7PSQ5 | 3-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.