DPCstruct | MC62364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 157 ± 18 aa |
| Standard deviation of domain lengths | 17.74 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 36.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5I611 | 37-210 | PRFKLKQLCNALDVFENWKRAGFRVRRVEALGIMRFFAQAELIETREMEISEKWYELDEDFHSAASHQMINADMSLYDLVAMPAHEA… |
| A0A6H5I8V2 | 146-300 | SSRLLANVERLETRGYEMSLSDALKVMGFFDWSEMFDTGKSWNCSEEFASQAKRAMLNPNLSLHDLIQLRPDEAARLLADTNPYYHQ… |
| A0A6H5IAH7 | 658-834 | None |
| A0A6H5I3G3 | 310-465 | None |
| A0A6H5I3Z5 | 330-491 | None |
| A0A6H5I4A8 | 339-508 | None |
| A0A6H5I5U6 | 112-275 | None |
| A0A6H5IQ23 | 962-1128 | None |
| A0A6H5I645 | 734-900 | None |
| A0A6H5I759 | 1043-1233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.