DPCstruct | MC62362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 163 ± 20 aa |
| Standard deviation of domain lengths | 19.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07035 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5I353 | 109-266 | ESLSEHGIPVQHYLHELIITTLVHKQAYYQLHQLLQYHVVSDSKPLACLLLSLENHYPAAHQLALDMLKRLGNAHEEIVEVLLSKGQ… |
| B4FDK6 | 2-195 | TQHGQHAGTVAISPIEMFQSVFTLVEDEMMGDPAYLIAVIIEFLRSVSKAGLKAPHNLYVMTATLLARSNRYAEIALFVSNKILEPC… |
| A0A7R9YJT0 | 24-176 | None |
| A0A482WTJ1 | 4-150 | None |
| L9JED8 | 870-1044 | None |
| A0A814VUR9 | 732-905 | None |
| A0A7M3RZA3 | 23-169 | None |
| A0A182FI73 | 642-787 | None |
| A0A3P7F9E7 | 866-1039 | None |
| A0A0R3T4Z9 | 279-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.