DPCstruct | MC62360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 873 ± 87 aa |
| Standard deviation of domain lengths | 86.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 41.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5HZM1 | 1-933 | MLSTLRLTRCTRLLVERKKARGHARCFRTSAKISDGLFDREKFETRHIGPREHEQEEMLKFLGLKSLEELTTKAVPANILFNKALDI… |
| A0A656B1S1 | 1-794 | MALCQRAGKSKSNLFFVADDVHPQTIEVVKTRAAFLGFEVKVDSIDNITQQEAFGALLQYPGTTGEVRDLTDIIAKAQANKTLVTVA… |
| A0A7R8CUT1 | 110-1074 | None |
| A0A6A1W662 | 26-981 | None |
| A0A2A6B720 | 18-896 | None |
| A0A6A6UK42 | 426-1246 | None |
| A0A6A5L9W1 | 1-940 | None |
| A0A672PZ30 | 4-720 | None |
| A0A3R7YC69 | 278-1221 | None |
| A0A087SIZ8 | 242-1162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.