DPCstruct | MC62353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 174 ± 30 aa |
| Standard deviation of domain lengths | 29.58 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7IEJ3 | 18-137 | GCSCDATCRQYGDCCRDSQYYDAAEQTKNVNEYECVDDPLYDGVNVYMRAKCLEKWNNTEVQALCLMGNTQTGDSKLFPVISTTTAT… |
| F6Y1F2 | 1-209 | GVILLFCALFLCVLASSNDEVTVSPAITQPCRPYDSCQKRCVKKQIALNQQINVTLGHLNCLCDQDCETFGDCCWDYQTECVPRPGG… |
| A0A8B6BIS4 | 1-206 | None |
| A0A817KM52 | 7-194 | None |
| A0A5B7DGK6 | 32-200 | None |
| A0A2G8LRG7 | 52-241 | None |
| V4CAQ9 | 1-206 | None |
| A0A4Y2LB40 | 2-182 | None |
| A0A8B6EXL1 | 49-183 | None |
| V3ZY20 | 11-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.