DPCstruct | MC6235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 6.82 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376VFE6 | 100-173 | YFVDPCKLLLTTPGIDAETGEYSDFGVPATILAHYLRENGIVPEKCDLNSILFLLTPAESHEKLAQLVAMLAQF |
| A0A447J139 | 11-83 | IFVDPCKLLLTTPGIDAKTGNYEAFGVPATILANYLRENNIIPEKCDLNSILFLLTPAESMAKMQHLVAQIAR |
| A0A365VPP6 | 44-115 | None |
| A0A447QJ10 | 1-59 | None |
| A0A7K4BFA5 | 339-417 | None |
| A0A377BZR0 | 6-84 | None |
| A0A447TPN5 | 80-162 | None |
| A0A7I8CHL0 | 179-258 | None |
| A0A6N8KAJ1 | 52-126 | None |
| A0A223RNQ4 | 607-676 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.