DPCstruct | MC62347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 160 ± 14 aa |
| Standard deviation of domain lengths | 14.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6W3B1 | 1-191 | GPTGAFSQQQVTGIVEVSNTNDSPYFESGISSLELPVYSASALNNLGITVKDLVKDVYRDIDPTTNLGVAVINTDSSLGEFEYTCSV… |
| I1YFH8 | 128-293 | AVNDAPVASGSGTLASINEDNTNPAGAALSSVITSSQYDDSTDTVAGGSSATALGGIAIIGNAANPATEGSWQYNSGSGWVTITNVG… |
| A0A6S7K9K9 | 58-233 | None |
| A0A6G9SPZ9 | 13-162 | None |
| A0A0Q7GQ29 | 91-251 | None |
| A0A2K1FY06 | 282-436 | None |
| A0A7Y9FU60 | 3-172 | None |
| H0C1X7 | 4-141 | None |
| A0A429VBR3 | 111-253 | None |
| A0A4Q3QRR9 | 3-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.