DPCstruct | MC62343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1872 |
|---|---|
| Mean domain length (aa) | 166 ± 36 aa |
| Standard deviation of domain lengths | 35.89 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.34 |
| Pfam Score | 97.14 |
| Assigned Pfam label(s) | CL0023- PF07851- CL0644- CL0290- PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6TMW1 | 20-177 | ASRRNVPEPPSNFTWVDPGWLAACASPTCPSHHKFLFECGIRHVISLMKQRPTNAMESVQLPKLNRLKIRIDDYCAPTLNQIRQFIR… |
| A0A2Y9MA19 | 155-280 | MHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIVQNSSGCNRYPEPMTPDTMIKLYKEEGLAYIWMPTPDMSTEGR… |
| A0A7S3J0B7 | 1-217 | None |
| A0A819M7Q4 | 4-152 | None |
| A0A7R9KBM9 | 26-233 | None |
| A0A7R9KVF7 | 3-143 | None |
| A0A7R9KWE1 | 1-143 | None |
| A0A5J5V166 | 2-195 | None |
| K4A9L7 | 161-327 | None |
| A0A3Q7SL95 | 5-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.