DPCstruct | MC62333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 99 ± 15 aa |
| Standard deviation of domain lengths | 14.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q0H3Q9 | 8-79 | ATRRLVEQHLLPLMARARVRYIQVARRGPREADGVEILSDTRTPDRLYPVGAWTLAHEMLDGGTVPQTTGDR |
| A0A291RR80 | 34-110 | STCELVERFVLPILTEHHVRMVEVARAGPAVADGIVVSQDTREPVRLHPDPDKDRFFSLSQENRTNGVMPQLGGTRK |
| A0A1J0TYZ5 | 18-118 | None |
| A0A4D4MEC7 | 2-115 | None |
| A0A429FGC6 | 20-106 | None |
| A0A2N0J8B2 | 49-141 | None |
| A0A0H5CI05 | 70-193 | None |
| A0A1Z4JRH0 | 32-150 | None |
| F4CWP1 | 35-136 | None |
| A0A1A2XVE3 | 46-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.