DPCstruct | MC6233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 146 ± 22 aa |
| Standard deviation of domain lengths | 22.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09937 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832EX85 | 83-241 | IGNAYTPSNIPRNRLNVGIKVGSNKKVIQVIGNRHCIFRKGLSPLITEPEPFTIMPIRYENAYGGIDQLSIPDLYFAYPRNNMGKGF… |
| A0A3S5D4I5 | 1-152 | MSVFRSENIRKVLRIFGPRYWVKEDDEWFLTESEPISYLDIRYEHASGGTYSAGDTVFTSPANPVGMGWYPAEFLAQCDKTQLPTHQ… |
| A0A6B8QSM3 | 1-214 | None |
| A0A653X8S1 | 115-269 | None |
| A0A6N8MTB0 | 112-252 | None |
| A0A836R904 | 2-145 | None |
| A0A0M6ZVR0 | 102-229 | None |
| A0A5Q0BIC1 | 101-226 | None |
| A0A6B8QSG5 | 115-272 | None |
| L9UAP1 | 10-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.