DPCstruct | MC62327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 357 ± 65 aa |
| Standard deviation of domain lengths | 65.45 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849R219 | 6-378 | PVLKGVLDSSTTPDEYNTSQRGLDLMSIAFQVTQPEIDGCIDYIWIAGDDTDPVTGQKYYEPIIEQVDWLCDRAIAWAELGRANNAD… |
| A0A2H4V979 | 121-521 | ISSLLEELVLGKDGNGPLTRGVSAVTSLYSWSLNYANLFEGDGALTELERMNIKAIKAVQLFEQSSLTNPLGAQYEWTFAVTYPSFE… |
| A0A0Q3NW02 | 152-544 | None |
| A0A396QH24 | 17-391 | None |
| H8GWP8 | 392-819 | None |
| A0A177E737 | 2-281 | None |
| A0A7W7A4Z3 | 75-465 | None |
| A0A7S1TGH0 | 2-380 | None |
| A0A7V0JTZ9 | 20-445 | None |
| A0A1U7PZB8 | 6-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.