DPCstruct | MC62325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 188 |
|---|---|
| Mean domain length (aa) | 272 ± 42 aa |
| Standard deviation of domain lengths | 42.09 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 11.92 |
| Pfam Score | 72.28 |
| Assigned Pfam label(s) | CL0126- PF09458- CL0559- CL0005- CL0726 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849QJL9 | 93-350 | FPLEIGEVSVDHNWKRVAFNDTFIDPVVVANPLSYNGGDPAVLRIRNVDNTGFDIRVQEWDYLDGIHAEETVGYMVMERGAYTLPDG… |
| B5GVW9 | 120-356 | PTVVASEWSADKEVATATCPAGTNLVGGGQDARLRVNGYDNVIDGVEANAPSPDTPNSWKVQLHLGQARAFAMCTAEAPMPTVVASE… |
| A0A1J9RES6 | 1001-1270 | None |
| A0A7M5UQF2 | 353-724 | None |
| A0A1T3NN51 | 490-887 | None |
| A0A117VJD3 | 691-974 | None |
| A0A0G4H163 | 173-445 | None |
| A0A0G4HUD1 | 112-467 | None |
| A0A7R8X5E8 | 14-287 | None |
| A0A3A5HCM8 | 104-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.