DPCstruct | MC62321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 370 ± 55 aa |
| Standard deviation of domain lengths | 54.79 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4G8U6 | 1-382 | MDFLQLNPETSSRFRIPGGVDASEDEKQLIAALVERFPDPGLDLRRAALPDLVLRCREVAIEIWHLPFHLWKADHFRDFRAAFLALA… |
| A0A0C3AHJ9 | 1-315 | MDEAQFIEQYNAYLQTIADARITYVRRWLRDNTIRFGEKVEILALIRRFEGLAKELKAAVVLCGLSCSSCGLLCLDQKHHSGKHDCK… |
| W2PG38 | 323-787 | None |
| A0A2N0S1B1 | 535-867 | None |
| A0A2I1GKS9 | 286-618 | None |
| A0A0D0DC41 | 235-576 | None |
| A0A0D0CNT0 | 1-285 | None |
| A0A067CRK7 | 469-847 | None |
| X6NFC7 | 182-651 | None |
| A0A6G0W9I8 | 134-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.