DPCstruct | MC6232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 5.47 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 54.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06440 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X1TGD9 | 1-74 | MHNIANLPQDEKDKINADLAAAGIAYKERLGLPYDLYETENQQPEHLRPYFRERLEHYREIGKRFPRGFEYEKE |
| A0A4U9DI22 | 55-126 | WNIASFSKEDQDKVSVDKAAAAVAWQERMNKPVVSELAAREQPEHLREYFQERLRIHRLNSQQLPRANAPEY |
| A0A3S8X8Y0 | 3-60 | None |
| A0A2L0TCC5 | 2-78 | None |
| A0A292AIR0 | 2-69 | None |
| Q93GP8 | 2-74 | None |
| A0A1Y0L827 | 1-66 | None |
| A0A0A2V7N8 | 2-64 | None |
| A0A1X3KRR4 | 32-95 | None |
| E1SFZ0 | 79-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.