DPCstruct | MC62317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 221 ± 40 aa |
| Standard deviation of domain lengths | 39.74 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 32.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4FYL9 | 7-213 | LRSEARRLLCVSGALGVKRFWKFTSLSKQLLALRDDPSLLGLGSIVSAGCLESVSEREALQFFLFDCIERKNVKALKQLCAVKGVPQ… |
| A0A0G4FDF3 | 11-273 | KESGTSSTSDTEKRDVCHKVCASAVLGVRLFWKLSSLSTELRVLRQKDCLKDVFSPENQVPLSERSELRSLVHDCIDRDDVTALKHL… |
| A0A0G4FVW7 | 1-188 | None |
| A0A0G4GQ89 | 1-269 | None |
| A0A0G4GQ75 | 3-281 | None |
| A0A0G4GN68 | 3-240 | None |
| A0A0G4G697 | 6-183 | None |
| A0A0G4I3D6 | 12-205 | None |
| A0A0G4HMV1 | 1-133 | None |
| A0A0G4HHY6 | 3-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.