DPCstruct | MC62314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 169 ± 28 aa |
| Standard deviation of domain lengths | 28.06 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.75 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | PF08507- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4F3B0 | 13-181 | IKNAAEATIHAGDDMRRKTLDWWDKHRRDFDGPIGLRVLAVIGGFALCVVAVLDLLSFFGILFDLTGKIMHVYLLLGGLCVLCFEAV… |
| A0A2U1JEJ0 | 1-123 | MAKYLDYNLLLFFMNILNILVCMMLGSVGLSNLISRELPTSTLVYNFYIIMISLALIVCEFKPPLFLAVNMKFLLTYRGRGLFYIFF… |
| A0A7J6L853 | 311-476 | None |
| A0A7J6LRV5 | 250-436 | None |
| W4GWU0 | 21-220 | None |
| A0A7S1R7E3 | 20-211 | None |
| A0A7S2VJ15 | 150-336 | None |
| A0A2K1JCP4 | 64-253 | None |
| D0NGH4 | 27-212 | None |
| A0A7S2MMX0 | 46-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.