DPCstruct | MC62313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 105 ± 18 aa |
| Standard deviation of domain lengths | 17.72 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.60 |
| Pfam Score | 98.33 |
| Assigned Pfam label(s) | CL0172- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4F1V9 | 14-120 | TANPVKRNHDLKRRKKDMDQIHEEMKNPPKLVVDEDLPGRGMHYCIPCARYFESREVLEGHAKTKTHKKRLKESLQDPYTQRDAEEA… |
| A0A1E3Q1U6 | 7-95 | SKTKRRTRDLDQVHQDLSSKASVQKLSNQPLDESKPGLGQYYCIECAKYFETDFAKTVHRRGKNHKRRVRMLKEQPYSQAEADAASG… |
| A0A146HN49 | 6-120 | None |
| A0A4Q9LC10 | 2-124 | None |
| A0A507DXT8 | 117-219 | None |
| A0A078A6H2 | 418-522 | None |
| A0A218YUQ8 | 7-102 | None |
| A0A1R4AAU4 | 1-89 | None |
| A0A5J4PR93 | 2-110 | None |
| A0A0R3URR7 | 2-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.