DPCstruct | MC6231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 9.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21738 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0U0D2 | 39-135 | FSEMQYEINGIEIQKLKTPGVSSCLKAYCSYTPNDLNTLDNCAWDLEMDGEDNKNFMTDNVFTGCIPLKHLFGFCEDYKKILLNCNQ… |
| A0A026WKP0 | 1-96 | MFDEIRYELDGVEIDRNKNVGITSTLKNYAMLSPDRALILTNAGWDIAYQRVVEGDFNFCVPLNMLLGFCEDYKHVVINARHELILI… |
| A0A151XJI8 | 24-132 | None |
| A0A151I8U9 | 123-210 | None |
| A0A151ICU3 | 163-274 | None |
| A0A6J1PHX2 | 5-138 | None |
| A0A3L8DMX1 | 1-108 | None |
| A0A3L8DUR8 | 269-373 | None |
| E2BXQ6 | 1-105 | None |
| A0A6G0Y8C5 | 2-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.