DPCstruct | MC62306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 102 ± 9 aa |
| Standard deviation of domain lengths | 8.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V5HA76 | 1-88 | MLEAYKKYILLALILYGKVPSLPKYTSQVVTRFIRPLSQPYLDLAAAYTSNNPDEVRAVLTKHAETFSRDNNTGLTKQCLASLYKKNY |
| M7Z2S5 | 120-223 | TAPMSSLNAITVEAYKKYVLVSLIQSGQVPSFPKYTSSTAQRNLKNHTQIYVDLSTCYGTGSYSDLETFIQSNAEAFQTDNNFGLVK… |
| A0A2I0XB78 | 21-139 | None |
| A0A3L6PM14 | 548-650 | None |
| A0A3M0LEL7 | 180-282 | None |
| L0P7T5 | 115-202 | None |
| A0A3M2T4Y4 | 515-617 | None |
| A0A7S3RV31 | 163-266 | None |
| A0A0D3B137 | 79-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.