DPCstruct | MC62304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 155 ± 22 aa |
| Standard deviation of domain lengths | 21.86 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10222 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V5GMD5 | 19-172 | FLFKDSHLELNTQPKDLHRELFFRRISYGNATHLNVSVVLGDDNKALLRVLLDRSDRDYYACDGGCLDPPVKLDFKPKQFPVKLTAP… |
| A0A0B1SYE2 | 252-395 | ELAFGGLPIGVGVAEASARVRIDDENTPYFEVSATGTLYACGGGCLGEPTTLSKMPTKLEIKVTKPETAILYIATSRRHLEQLRSTI… |
| A0A1I8I8V1 | 442-589 | None |
| A0A087YHF5 | 458-595 | None |
| A0A803K328 | 441-588 | None |
| A0A7R9MUP6 | 20-159 | None |
| A0A7I8VDP1 | 391-585 | None |
| F6UFS0 | 2-163 | None |
| A0A2I0TX18 | 310-447 | None |
| A0A2P8ZH35 | 283-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.