DPCstruct | MC62302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 184 ± 26 aa |
| Standard deviation of domain lengths | 26.06 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.82 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | PF14838- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V5GFR4 | 2-197 | KIVALLLVEMVSSDVMFNGLPWPDEDFLKVTMERDLHIQAMFVEHPVLWDLLHLVASVRPSLCYCSVLLRAVMAVAMTHWRNCQEKA… |
| A0A0B7AFA4 | 214-402 | ESSARTLGCIIVDNLTMDSLYNDVHWLDPDFRKVTTERDTLVWKRLEVLPLLWDVIQEFSSSCVFLYYLSPVLRSLMAVTMNHMEVS… |
| A0A0R3QE73 | 2-136 | None |
| A0A0A9YRL2 | 1-164 | None |
| A0A7R9QFJ7 | 58-229 | None |
| T1PHE5 | 285-512 | None |
| A0A813T4E8 | 691-873 | None |
| A0A820YP38 | 13-173 | None |
| A0A819M713 | 252-432 | None |
| A0A7E5WY41 | 1-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.