DPCstruct | MC6230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 99 ± 14 aa |
| Standard deviation of domain lengths | 14.29 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 41.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151IEC2 | 1-69 | MDRRSSTARPAVRGCWNCGSDGHRYSACPRPRKGAEFCFGCGRAGVTLRTCPRCRVDWEDLGPYHPGNG |
| A0A026W2C1 | 3-109 | ERATADPIREQLVPAEPPRNPTASSGCWNCTGDHRYVNCPLPRMHSFCYGCGERQVTLRNCPRCGPFYQRTSPYRAPRGPRDGRRGP… |
| E2AXS6 | 105-210 | None |
| A0A0J7K738 | 65-181 | None |
| A0A3L8E0R5 | 61-155 | None |
| A0A0J7K2V1 | 237-325 | None |
| A0A0J7KDJ3 | 143-226 | None |
| A0A151K1P2 | 94-193 | None |
| A0A0J7MP01 | 1-118 | None |
| A0A0J7K1K6 | 145-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.