DPCstruct | MC623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 82 ± 12 aa |
| Standard deviation of domain lengths | 11.55 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V2IKL6 | 6-84 | GLSRDDRLADGPAQAARWLTARLADEPAYGSDVLREAADEGFAKSTVQRAAQHLGVQKIRSKDDGNRFLWSLCFDPDAS |
| A0A842UE34 | 2-70 | EKTKLIDQARGFLIEQILDGPKLSSKIFEEGSKRGLNERILRRAREDLGFETYHYGKSGDWWWYDPKLE |
| A0A3M0Y4R9 | 121-205 | None |
| A0A2W5ZLY8 | 49-143 | None |
| A0A1I3X6G2 | 529-610 | None |
| A0A0E1UGM1 | 150-224 | None |
| A0A847JZ11 | 179-252 | None |
| A0A378YWT5 | 120-193 | None |
| A0A2M6WZW6 | 5-89 | None |
| A0A7V2XFV6 | 389-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.