DPCstruct | MC62298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 153 ± 21 aa |
| Standard deviation of domain lengths | 20.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0JPV8 | 32-155 | SVPLWEKKFCTDACAIPWGKLCETKKLMPLYKNVVDWDDSAALEAFNDAKARFCAVYHGQPCDIPLPDPNMYIDMVNQDEHVDPELV… |
| A0A833VHP6 | 9-167 | EQRKTESNKRGSSSRNNRNWSHGKPPRFSDEKPEMHSWEQNFCKLNGVSWAKILKTKDFVHQFSDITSWNDSAGKEAFQGAKARYWA… |
| A0A7N2KMR8 | 5-153 | None |
| A0A2N9IEP5 | 19-150 | None |
| A0A1D6FQQ4 | 2-151 | None |
| B9RIG1 | 1-156 | None |
| A0A7J6EAU0 | 1-127 | None |
| A0A834Z1U0 | 3-148 | None |
| A0A2I0W7L2 | 12-177 | None |
| A0A072VHK7 | 2-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.