DPCstruct | MC62296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 9.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 48.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833VBT4 | 11-90 | GSLRPFHVALTATADPYSRWQSRIMYYWYKAIKAQPDGSAEMGGFTRVLHTGKPDRLMDEIPTFVVDPLPPGVDRVSILS |
| A0A7S0H297 | 232-301 | RFHVVVTTNANIYQAWQVRVMYYWYKEMKKRQDPIHGQMGGFTRVLHDDADALIDEIPTCVVNRLENEMG |
| A0A0D2MPA4 | 199-285 | None |
| A0A287VVN4 | 89-170 | None |
| A0A453EQG2 | 136-213 | None |
| R1DEH4 | 89-161 | None |
| A0A2Z6P1S4 | 40-133 | None |
| A0A5J5C444 | 136-216 | None |
| A0A0M0K2W9 | 1-87 | None |
| A0A7J7PAD7 | 8-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.