DPCstruct | MC62292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 114 ± 17 aa |
| Standard deviation of domain lengths | 17.11 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 47.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833RK36 | 1-124 | MGQISNLLNGLVNSMSPRKEKKGQQEEELRKEIVLKSSGWVDGTGSNCFVSVYTQTGQKGVNQDRSIVWEGFGCQDDTIFCGVFDGH… |
| A0A1R3G6C2 | 11-103 | MLSSSGTVKSNRSNNFASVCSKRGQKGINQDCAVVWEEFGCQEDTIFCGIFDGHGPWGHIVAKRVREWVPPSLLCNWQKNLIASTST… |
| A0A4S4EPK6 | 159-254 | None |
| A0A835PZ78 | 25-163 | None |
| A0A7J7GXJ1 | 25-119 | None |
| A0A6G1FGN7 | 76-199 | None |
| A0A446VDI8 | 76-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.