DPCstruct | MC62289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 188 ± 28 aa |
| Standard deviation of domain lengths | 28.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 26.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07815 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7IIC3 | 3-137 | AEGGMSVTDLQELIDKRIPDNRTQLETSHANLMDVADYCEDNYLKERYQEKALAESKQYAIQSLASVAYQINKMAADLLDMLELQTE… |
| A0A833R7U8 | 19-226 | APVSRCSSFLCSEATTEAEQFEGSLRELKDLRSQLHQAADYCEDAFLKEEKKKMILDSTKSYICDAIVAVIDHLGTVSSKLELELCN… |
| A0A6P6SLV1 | 4-222 | None |
| A0A834Q245 | 8-159 | None |
| A0A6I9RDF4 | 20-205 | None |
| A0A183TIY1 | 4-222 | None |
| A0A835J3K3 | 5-208 | None |
| A0A1I8ICR8 | 1-202 | None |
| A0A0L9VGP8 | 2-160 | None |
| R1CBT2 | 2-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.