DPCstruct | MC62277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 9.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6EXM7 | 77-173 | TIADIKSSPRVVEDLDWPFDFSLPRADDDSDWIHLKPETPFTVIAGDGTGGVFLAYGSGDVEVLPVLHGTSEGQAGKVASNLTEWLP… |
| A0A1C6Q4Q1 | 5-91 | ITAVYQQDEATGFLAWPGDFDLDRGDHVEEVHLASGATLEGFAGDGAGGTFFFCGEGGEERPVLYADSEGCAALVAIGLPVLLRLLL |
| A0A4R5F8Q5 | 104-183 | None |
| A0A6B1PL77 | 1-109 | None |
| A0A066YKV7 | 3-91 | None |
| A0A7G1NQH4 | 155-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.