DPCstruct | MC62274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 226 ± 24 aa |
| Standard deviation of domain lengths | 23.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14775 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818JMX5 | 40-276 | ATMKAILELLCDEGDFLVEPKLLALLDPLETNEKSLIKLDAIFRALKVENEEDIKVMAKFFVDHIQQNKDKQSKTYVSSGVGPEQHE… |
| A0A7R9UI57 | 11-219 | LDNEQIRGMLQLLTNEAAFLVEAKVQKLLEPLPLDEQNLLRIDSILKVLGVESAADVEKMLGYFLADADDHELIHPNDAIKAIKAFV… |
| A0A7S3F3U7 | 196-399 | None |
| A0A7S0RVI2 | 2-192 | None |
| A0A0L0TCI7 | 11-245 | None |
| A0A1A9UYE0 | 6-227 | None |
| A0A2R5GAA1 | 479-715 | None |
| A0A812LW06 | 469-682 | None |
| F1SDN3 | 450-648 | None |
| A0A820L713 | 86-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.