DPCstruct | MC62270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 206 ± 24 aa |
| Standard deviation of domain lengths | 23.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9KVY1 | 1-177 | MSNNNYLNSWDGNLLFHMNDDYTPRCDFNRMLYKGCPNTKYIQQGNTVEYAHRYEIIFQFKERFEEKMKEGCSHATLSLSYIKLMSF… |
| A0A2R4AJE1 | 33-215 | MVICVNGSILRFERFAFKSCPVLFRGFRKVETSQFTDMKRSSFVRQIYSLLSENVTSTTASRYETLIKYVRWVDDSNDTELIDKDMF… |
| A0A1V1V7H2 | 1-213 | None |
| A0A1T4UXA8 | 1-215 | None |
| A0A4U1M3E8 | 28-207 | None |
| A0A3M7LI53 | 27-200 | None |
| A0A4U9W3M5 | 13-219 | None |
| A0A8B3GNK0 | 3-216 | None |
| A3UUQ8 | 13-241 | None |
| A0A1E5IXZ9 | 1-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.