DPCstruct | MC62268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 107 ± 6 aa |
| Standard deviation of domain lengths | 6.03 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 70.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 45.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836DXW5 | 55-149 | NVEPDFVRYRMLMQQKIFTIISQRQSQPIGDLQKQKFKEFARRLEEGLFKAAQTKDDYVDMSTLEIRLSSLLKRPLQIAKTNGINSL… |
| A0A565B2C9 | 48-155 | SRVPIDNDILKLRQAMRVKIFNILQQKQPSPADDASKAKYMDVARRLEEGLFKVANTKEDYMNQSTLEPRLASLIKGRQLNNYNQRH… |
| A0A6P5RSP8 | 26-138 | None |
| A0A6A6M8M1 | 47-156 | None |
| A0A059C2M8 | 203-301 | None |
| A0A059C2A3 | 37-146 | None |
| Q9C5X9 | 46-153 | None |
| A0A565BP18 | 1-107 | None |
| A0A022RT28 | 14-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.