DPCstruct | MC62260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 10.25 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2YJV9 | 21-103 | VDKPRFSQSQLRSLFQPLHLRIILTGDSMQIHGQLVFDVFASPVLSADNSSVRYDGVATFIEDEKEFTYVLADGAAYLTVTPY |
| A0A6A3E1I1 | 1-99 | MKLLFVLAPVFAALFAITAQAVATERTSTDTIWLSLRFRFTIKRSSMQVHGHSDFSVLANPIVSVLDTGNRVLYDTFATFTEDSTLY… |
| A0A833WCV7 | 15-107 | None |
| W2LXP9 | 584-697 | None |
| A0A081A8G6 | 1-118 | None |
| A0A6A4BE57 | 1-105 | None |
| W2N3W8 | 5-117 | None |
| A0A2P4XZB5 | 23-118 | None |
| A0A425CBS3 | 1-93 | None |
| A0A484EAV2 | 324-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.