DPCstruct | MC6226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 89 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J9E9S1 | 3-86 | RQWPTYSDTNGNYVYALPIKAIRQTVDGYAYASFDGDNDDQYLSAQFMTIFRPVVGGYLFNSASGELLYMSKTTFEAQYSAQTT |
| A0A2P5IIE4 | 6-85 | STNYPRWRSHKVVQAFQIAQINHAPDGAALSPSDPQLASVQVNADWVNKHNPQVGGFYVIYGDSYASYSPKEAFMDGYSL |
| A0A7C1S286 | 14-108 | None |
| A0A7Z3BK44 | 4-86 | None |
| A0A526VKE2 | 2-93 | None |
| A0A377BFZ3 | 13-102 | None |
| K1XCC1 | 25-110 | None |
| A0A644RKN0 | 6-99 | None |
| A0A1M7YP46 | 23-116 | None |
| A0A7U1H3X6 | 5-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.