DPCstruct | MC62253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 153 ± 29 aa |
| Standard deviation of domain lengths | 29.36 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W6DKX1 | 5-143 | GDWDQSREPLPETRAARVIHDHFVKGMSWAETGIVDYHLGKIAEKGISEGARTLEEIMARYEDLDRVYEDAQKTGTLRPRSELPGHL… |
| A0A1M6ZD00 | 249-416 | EIDVAPRELQHELDYQGAFPDRKQRHRIGNRLLWDGNWDVSLTAFLASRRMHFIADIWYHRRRLEQSHSYHRLAERLARGKPIVSHS… |
| A0A1H8U422 | 23-184 | None |
| A0A5D5AGQ2 | 3-138 | None |
| A0A1G7HX90 | 46-236 | None |
| A0A5K7Y033 | 80-250 | None |
| A0A7G8HBE6 | 1-132 | None |
| A0A640VJV0 | 208-379 | None |
| A0A4R7RXX1 | 46-190 | None |
| A0A7Y2C821 | 23-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.