DPCstruct | MC62249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 80 ± 12 aa |
| Standard deviation of domain lengths | 12.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1IVQ5 | 3-81 | QAKVQMSQLVAKYIMELRNRQPRGPYNLGGWSAGGICAFEASRQLQEAGEVVQSLILIDSPNPIGLQNPPARIPEMKPN |
| A0A450UMC9 | 29-92 | SEPDTRVEAMAARYIREIRTVQADGPYLLGGHSLGGWVALEMAKQLRQEGEQVARLAIFDTTVP |
| A0A6N9XL53 | 8-95 | None |
| A0A2V5J4X7 | 57-129 | None |
| R0K3W3 | 35-108 | None |
| A0A421DD26 | 1037-1111 | None |
| A0A6G3UX58 | 114-224 | None |
| A0A6G3V143 | 1-86 | None |
| A0A6G3VJF8 | 169-239 | None |
| A0A4P9XI27 | 102-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.