DPCstruct | MC62247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 361 ± 53 aa |
| Standard deviation of domain lengths | 53.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423VBZ8 | 33-412 | LARVWPANDATSIWVELVEGRRKEIEDKWNQNYALPYQSLASAAQSQISRASLAEWDASARSWLRTADRVKVKCQNQLMILVANVNV… |
| A0A135T0D9 | 108-473 | FADHVGIDGTSIWAAATSGPDAIAVHLLTCLLARIWTAPEAISIWVELVANRKRELENSQQTEALHSRSVEASRISVSRDQLAEWDA… |
| A0A1L7WEG2 | 140-402 | None |
| A0A175W0R0 | 2-330 | None |
| A0A4Z0Z071 | 140-461 | None |
| A0A5Q3DTL0 | 108-476 | None |
| A0A4Q4Y9D3 | 145-515 | None |
| A0A072P2T0 | 2-320 | None |
| A0A2J6Q1F0 | 112-477 | None |
| A0A3M2SC58 | 116-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.