DPCstruct | MC62241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 162 ± 21 aa |
| Standard deviation of domain lengths | 20.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.84 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF11181- PF11821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1BJ93 | 3-177 | EKILYGYTGIFNTPDEIAHAAEKAVAKGFTKFDVHTPYPLHGMNKAMSLKPSKLGYVALVLGLSALMGAVFSLWWVSAVDYPIVVGG… |
| A0A6I1F5B6 | 2-145 | FLVGSFNQSVELEIALSKIEELGVTPEKILIVFMNDHLPSRSKKKSLEEVQSTAFEIGIAIATGLSVIGASIGFKLPIGPIFTGLLF… |
| A0A4R8LID7 | 266-417 | None |
| A0A2N6RBS3 | 2-148 | None |
| A0A0M0EEY1 | 2-158 | None |
| A0A518AGY4 | 13-197 | None |
| E3J5A9 | 154-316 | None |
| A0A2N5C6W4 | 52-212 | None |
| A0A1E4BHD3 | 1-167 | None |
| B2UN76 | 6-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.