DPCstruct | MC62239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 139 ± 19 aa |
| Standard deviation of domain lengths | 18.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.43 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | PF15833- CL0001- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401SPV8 | 16-172 | ALPVLVYARYSYRQTLDFLSEIDLVHTIGEMAAMGASGVILWGNNNYARTEETCSNLKTQIDENLGKFVKNITTATMWCSRLLCNSN… |
| A0A2J8TH82 | 99-252 | LPVLPYVQIFYDMTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHG… |
| A0A6A4VBA8 | 70-187 | None |
| A0A7M5V450 | 21-181 | None |
| A0A669C807 | 43-157 | None |
| A0A4Z2ELW2 | 11-150 | None |
| A0A0N4VSH3 | 418-575 | None |
| A0A154P1H0 | 192-312 | None |
| A0A3B5QX79 | 315-465 | None |
| A0A4Z2HHE5 | 185-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.