DPCstruct | MC62236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 149 ± 14 aa |
| Standard deviation of domain lengths | 13.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 66.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401SCV8 | 25-169 | DISWRVEVDELETRRVPSPRGFSPASPFESFYPPLLSKGTSSPPGNNHFLQSFPQACTNEENCTPARRSQGLSKKMSGKRRMKASER… |
| A0A672H7F3 | 1-118 | LCDMDLDAITADMLSEWETHETAFGESPESLQSNSESSIDCMCSSPEMQTKTKMSTKRRMKASEREKMRMRSLAEALHQLRDYLPPD… |
| F1QZT9 | 1-151 | None |
| A0A060X5M9 | 64-216 | None |
| A0A3Q2D4F4 | 1-182 | None |
| G3P274 | 5-137 | None |
| A0A3B4XQQ8 | 14-159 | None |
| A0A2P4SSW3 | 2-159 | None |
| A0A3B3Q6E8 | 12-158 | None |
| W5Q5L4 | 122-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.