DPCstruct | MC62234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 216 ± 17 aa |
| Standard deviation of domain lengths | 16.92 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.91 |
| Pfam Score | 86.65 |
| Assigned Pfam label(s) | CL0125- PF20908 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401S9D1 | 1-201 | MVVQHNKTSRGHFKLTLPIDVLVFAKPEEPLGKLQDQFVESVTTQVAAMSDCIQRYTKGKTVPQPQAFHFELPEKMPLTTVIFPAGV… |
| A0A1S3W4I3 | 43-281 | VTAVTPIIERESGGHHYVTMTLPVDAVLSVAPEETWGKVRKLLVDAVHNQLNDMEKCILKYMKGTSIIVPEPLHFLLPGKKSLISIS… |
| A0A287X2I3 | 120-330 | None |
| A0A1S0U355 | 222-431 | None |
| A0A453S7P4 | 1-237 | None |
| S9YNS1 | 3-252 | None |
| A0A5J4VR02 | 269-493 | None |
| A0A0S4KRH5 | 199-434 | None |
| A0A0R3UK97 | 144-344 | None |
| A0A7R9PYL9 | 178-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.