DPCstruct | MC62226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 164 ± 23 aa |
| Standard deviation of domain lengths | 23.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6T1DER4 | 1-213 | AQAVAAQGPPPLCQRVVRASATQVAAMPSYYETIDGEKLDKAIIDECRKAVEGQGDGRVSKEDAAKVFAKVEDGGKETRCERWTMRY… |
| A0A7C5INT1 | 1-155 | MAEYKTINGVKYDKPLLEAAEKAIEGVGDGRVSFDDAKAIWADAMEDGKITKVEVRTIKYILENYKCTDKGREFLQGHVFRSIGGVI… |
| A0A812K0H0 | 1-173 | None |
| A0A7S2KHA3 | 1-165 | None |
| A0A2C6CT59 | 1-148 | None |
| A0A812Q6F6 | 12-146 | None |
| A0A5E8A1G3 | 71-208 | None |
| A0A7S4SS10 | 92-253 | None |
| C1N6W3 | 2-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.