DPCstruct | MC62220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 132 ± 17 aa |
| Standard deviation of domain lengths | 17.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.13 |
| Pfam Score | 65.71 |
| Assigned Pfam label(s) | PF00994- PF02464- PF18146 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1X918 | 2-119 | QMCRRVIRTFGYGESEAERLLDGLTARGRNPEVGITASEAVISLWITARATTEETARQMCEETEQQIRQRLGVAVFGDGDIELHDVT… |
| A0A6G3Z6X6 | 163-273 | WAETAVPYLKQQRWSSATIYSRTLKFWGVGESTLAERVDHLLNLENPTVAPYASQGTVKLRVSAKAVSEAAAIALIDPIVKEILKIA… |
| F2LXN7 | 116-272 | None |
| A0A2V7E918 | 381-534 | None |
| A0A7V2HZ10 | 162-294 | None |
| A0A7V0VZQ5 | 1-123 | None |
| A0A1H0C2N8 | 157-302 | None |
| A0A1V5Z917 | 11-107 | None |
| A0A840NQE2 | 6-145 | None |
| A0A2D8Z2H3 | 7-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.