DPCstruct | MC62210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 438 ± 88 aa |
| Standard deviation of domain lengths | 88.07 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 47.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V7IEX7 | 17-454 | VIDCKILRAKNIDIINSSIYLCGVKLQGSQELPNHPFFFGELDKEGNIKQEQPSYYFAPKDETLDKGKLTIYLHNLTLTLLNYSLSN… |
| A0A7U7XGK2 | 1-314 | VDKKQSIAKLHALLENQNLECIHGGKVILKSNKGKTFKDDGIPIMLESDLLNSSIVACPNTIAGVSVPCTKVVNVKGSLSQKKVNNE… |
| A0A809NLT1 | 10-558 | None |
| A0A5T0RXN0 | 1-310 | None |
| A0A508ZMB3 | 1-226 | None |
| A0A4V7IEH3 | 187-632 | None |
| A0A7M1CZ84 | 196-629 | None |
| A0A2A4L843 | 2-356 | None |
| A0A809NK18 | 101-574 | None |
| A0A7S9NKE4 | 749-1179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.