DPCstruct | MC6221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 149 ± 12 aa |
| Standard deviation of domain lengths | 11.93 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 21.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4GBD6 | 16-158 | YPSKPPRSALMYPQRYSQRLVASSATFIVPIAVAVCQNHWDFATLASLVLVTSLNHWRSPVFTSWRRRVDTTLVRGGTVYHLVQALK… |
| A0A6C0FDL6 | 2-135 | KITFYDEESYLVKTTSSFLIPSLYGALQGNYFNAGLNTLCFLVSVNFWYYPVRGVRRNIDLYFQPMFGTYMYILGNFIAKNPRTIPV… |
| A0A6C0DG08 | 2-137 | None |
| R1FJE2 | 23-189 | None |
| A0A0J9TKR5 | 21-172 | None |
| F0VEW0 | 309-466 | None |
| A0A812WJP8 | 184-345 | None |
| A0A6C0JX58 | 6-139 | None |
| A0A653HNI3 | 18-187 | None |
| R1DMJ4 | 363-512 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.