DPCstruct | MC62204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 161 ± 15 aa |
| Standard deviation of domain lengths | 14.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P0YFA8 | 76-233 | GDTVGSGDYQTFMAQLCATQIRDWLSAGQQGRALLWRGETSRPVQASDITVLVRNRLEAAQVREALQTLGIPSVYLSNRDSVFETLE… |
| A7BUG5 | 7-162 | NCPEDKPINKGWAKQRIPYSVGNEIARLLTLAQKGEALIGDKPLAAGDIAILVRTNSQAFSMQKVLTQLQIPSVLYSRESLFTSHEV… |
| A0A6M5Z8G2 | 1-193 | None |
| A0A1V1P8P4 | 327-492 | None |
| A0A377CVR4 | 3-142 | None |
| A0A2S7XPU9 | 25-159 | None |
| A0A3B8Z1A6 | 408-578 | None |
| A4NZ46 | 90-246 | None |
| A0A3P3ZLL3 | 2-162 | None |
| A0A3E0WPR3 | 369-526 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.