DPCstruct | MC6220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 118 ± 15 aa |
| Standard deviation of domain lengths | 15.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 34.43 |
| Pfam Score | 97.78 |
| Assigned Pfam label(s) | PF00066- PF06816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4I2F3 | 13-123 | CVVDNPGFIGDKYCDGSEYNTEGCSWDGGDCSEFNKKWPGCMVASPDRVGDGSCDGSQYNQNECGWDGGDCDDFNRKWPGCVVEYPT… |
| A0A0G4G8F5 | 169-265 | CRPFLLGNGVCDAECNTEACGNDGGDCKGDLCASGCHPEHRGDGFCDPLCNVAACKFDDGDCEAVKGCPGCSPPLLGDGQCDEVCNV… |
| A0A7S7LEA3 | 137-264 | None |
| A0A7R9VCJ2 | 996-1128 | None |
| A0A2A2KWW7 | 485-590 | None |
| E9I119 | 8-138 | None |
| A0A061RE86 | 50-167 | None |
| A0A3P6QM34 | 65-183 | None |
| A0A1E7EPZ5 | 8-121 | None |
| B6ABC3 | 175-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.