DPCstruct | MC622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 169 ± 48 aa |
| Standard deviation of domain lengths | 47.61 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 81.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8UA32 | 1139-1271 | KVYFQILPEPPREEWRATRQTLTIQSRSDLWRVCLKSQHARVEIPELEFEISADGKKHIDSIYNHIAQAIFNLGNYVSSSRASMPPD… |
| A0A158QN96 | 2-157 | ALTCDKCGLKTNEVKSGGAIKDHGCRLSLTIQEDVDLARDVLKSDTCSMGIPELDLEVGPGALCSRFTTVEGLLTATKEQLSSQSSF… |
| A0A6A5DCL2 | 446-724 | None |
| A4H999 | 1-145 | None |
| A0A6A2XX45 | 55-211 | None |
| A0A7J6UNV4 | 82-203 | None |
| A0A0F7SJA8 | 610-779 | None |
| A0A7S0DMP8 | 158-303 | None |
| A0A0C9YUK7 | 136-255 | None |
| A0A4W3GZ89 | 55-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.