DPCstruct | MC6219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 360 ± 56 aa |
| Standard deviation of domain lengths | 55.72 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.19 |
| Pfam Score | 41.67 |
| Assigned Pfam label(s) | CL0020- CL0302- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4G5U1 | 42-398 | GQRLRKLCQQPAHFQRIVSNAGVRCVLDLLVGIEVRRTHEGAQADLAVRPVAVEADDWMPVQVKSTKAVRKEEGADFSPRTYHFFRS… |
| A0A1Q9EUB4 | 44-432 | RFRADVMFQRIQHYVGFFDSEIEAAHAFDQKLRSLCPDDVVRLQKSLNFPTKREVSLFACQQERRERALQKSSERASKEEESFCLLQ… |
| A0A6C0LVM9 | 32-462 | None |
| W6YZ49 | 1-384 | None |
| A0A812R6Z4 | 5-339 | None |
| A0A0G4HGN1 | 393-803 | None |
| A0A0G4HN36 | 58-464 | None |
| A0A812L1X6 | 80-469 | None |
| A0A0G4HFW7 | 4-399 | None |
| A0A812NQU6 | 757-1155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.