DPCstruct | MC62186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 12.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5PTW6 | 3-73 | TITLEEALELFRLPREVGEYEGSPVVIGSGRFGPYVMHNRKYVSLPKDENPLTVTLETAVRLIEEKRKQEE |
| A0A849FUE8 | 17-97 | LKELGEHPESGGPVNVMDGRYGPYVKWEKVNATLPKGTEPADVTMDMAVELITAKAAKKGTRRKAPAKKKTTTRKKATAKK |
| A0A7J7QE22 | 868-978 | None |
| A0A7Y2CUC3 | 335-432 | None |
| A0A7V4PCN2 | 424-522 | None |
| A0A7X6UAN3 | 223-317 | None |
| A0A7C2KAK9 | 184-275 | None |
| A0A850KFW6 | 13-97 | None |
| A0A5J4YT53 | 806-878 | None |
| A0A7S3E3M1 | 125-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.